Protein Info for Pf6N2E2_2725 in Pseudomonas fluorescens FW300-N2E2

Annotation: D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF02826: 2-Hacid_dh_C" amino acids 103 to 274 (172 residues), 145.7 bits, see alignment E=9.9e-47 PF03446: NAD_binding_2" amino acids 137 to 224 (88 residues), 21.5 bits, see alignment E=2.2e-08

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a1368)

Predicted SEED Role

"D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 1.1.1.95)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.95

Use Curated BLAST to search for 1.1.1.95

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A055 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Pf6N2E2_2725 D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) (Pseudomonas fluorescens FW300-N2E2)
MRVLIAEHDHPVYAQLLRQAAPDIEVLTSGDSAELSRLATDCPVWLGQPDLLATLLRQGH
RPSWLQSTWAGITPLLAEGLTRNYRLTRAVGIFGQVMAEYVLTYMLGHEREVLARLVSQV
ERKWDNRQGQGLAGRKVLIVGTGDIGQRVAQFLVPFGVQLYGVASEARALAPFIEVGALK
DLPRLVGEADYVINLLPNTPDTHDVYDAALFKQFKPTGLFINVGRGVAVVDADLVQALKD
GHLAGAVIDVCRQEPLPQRHPFWTAWGLLLTGHSSAPTSPPMMVQLFLENLRAYQAGEAL
RGEVDFSRGY