Protein Info for Pf6N2E2_269 in Pseudomonas fluorescens FW300-N2E2

Annotation: NADH-ubiquinone oxidoreductase chain J (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 56 to 80 (25 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 133 to 159 (27 residues), see Phobius details PF00499: Oxidored_q3" amino acids 15 to 159 (145 residues), 121.8 bits, see alignment E=9.8e-40

Best Hits

Swiss-Prot: 76% identical to NUOJ_PSEAE: NADH-quinone oxidoreductase subunit J (nuoJ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00339, NADH dehydrogenase I subunit J [EC: 1.6.5.3] (inferred from 99% identity to pba:PSEBR_a3589)

MetaCyc: 89% identical to NADH-quinone oxidoreductase subunit J (Pseudomonas putida KT2440)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain J (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YQ01 at UniProt or InterPro

Protein Sequence (166 amino acids)

>Pf6N2E2_269 NADH-ubiquinone oxidoreductase chain J (EC 1.6.5.3) (Pseudomonas fluorescens FW300-N2E2)
MEFAFYFASGIAVVSTLRVVTNTNPIHALLYLIISLIAVAMTFFALGAPFAGALEVIAYA
GAIMVLFVFVVMMLNLGPAAVQQERSWLKPGIWAGPVILSALLLGELLYVLFAHQSGQAI
GHTTVGAKAVGISLFGPYLLVVELASMLLLAAAVTAFHLGRNEAKE