Protein Info for Pf6N2E2_2669 in Pseudomonas fluorescens FW300-N2E2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 TIGR02683: putative addiction module killer protein" amino acids 5 to 95 (91 residues), 130 bits, see alignment E=1.7e-42 PF05973: Gp49" amino acids 12 to 90 (79 residues), 24.2 bits, see alignment E=1.4e-09

Best Hits

Swiss-Prot: 54% identical to Y1419_HAEIN: Uncharacterized protein HI_1419 (HI_1419) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 73% identity to ppg:PputGB1_4036)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A008 at UniProt or InterPro

Protein Sequence (100 amino acids)

>Pf6N2E2_2669 hypothetical protein (Pseudomonas fluorescens FW300-N2E2)
MKKIESSKFRSWLKKLKDGTGRARITSRINRLIEGLPGDVAPVGHGISELRIHYGPGYRV
YFYQQGDVLVILLCGGDKGSQSRDIETAHQIMQAWRAQND