Protein Info for Pf6N2E2_2596 in Pseudomonas fluorescens FW300-N2E2

Annotation: Flagellar sensor histidine kinase FleS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF13188: PAS_8" amino acids 63 to 120 (58 residues), 43 bits, see alignment E=8.6e-15 PF00989: PAS" amino acids 64 to 103 (40 residues), 31.9 bits, see alignment 3.5e-11 PF00512: HisKA" amino acids 170 to 233 (64 residues), 48.5 bits, see alignment E=2.2e-16 PF02518: HATPase_c" amino acids 277 to 379 (103 residues), 90.2 bits, see alignment E=3.7e-29 PF13589: HATPase_c_3" amino acids 281 to 329 (49 residues), 25.4 bits, see alignment 3.9e-09

Best Hits

KEGG orthology group: K10942, two-component system, sensor histidine kinase FlrB [EC: 2.7.13.3] (inferred from 98% identity to pba:PSEBR_a1475)

Predicted SEED Role

"Flagellar sensor histidine kinase FleS" in subsystem Flagellum

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z9T0 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Pf6N2E2_2596 Flagellar sensor histidine kinase FleS (Pseudomonas fluorescens FW300-N2E2)
MPSAEQASRLGLEQAFSLFSQMSSQLTDSYSLLEARVTELKGELAVVSAQRMQELAEKER
LANRLQNLLDLLPGGVIVIDAHGRVREANPAACELLGLPLEGELWRHVIARCFAPRDDDG
HEVSLKDGRRLSISTRSLDAEPGQLVLLNDLTETRHLQDQLARHERLSSLGRMVASLAHQ
IRTPLSAALLYASHLTEQQLPMETQQRFAGRLKERLHELEHQVRDMLVFARGELPLTDRV
TPKALLQSLQAAALTHVQELPIRWQCDSHVGEVLCNRDTLVGAVLNLIENAIQASGGDVR
LKVHLYTRDNTLRLSVSDNGSGIEPAVLARLGEPFFTTKTTGTGLGLTVVKAVARAHQGE
LQLRSRLGRGTCATVCLPLFSNAPGVE