Protein Info for Pf6N2E2_2576 in Pseudomonas fluorescens FW300-N2E2

Annotation: Flagellar biosynthesis protein FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 710 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 242 to 268 (27 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details amino acids 312 to 329 (18 residues), see Phobius details TIGR01398: flagellar biosynthesis protein FlhA" amino acids 22 to 706 (685 residues), 844.6 bits, see alignment E=2.8e-258 PF00771: FHIPEP" amino acids 32 to 698 (667 residues), 868.3 bits, see alignment E=2e-265

Best Hits

Swiss-Prot: 53% identical to FLHA_YEREN: Flagellar biosynthesis protein FlhA (flhA) from Yersinia enterocolitica

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 99% identity to pba:PSEBR_a1495)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H4T6 at UniProt or InterPro

Protein Sequence (710 amino acids)

>Pf6N2E2_2576 Flagellar biosynthesis protein FlhA (Pseudomonas fluorescens FW300-N2E2)
LVDRSQLFSTARSNVVDLSRGNLGVPLLLLVMLAMMMLPVPPFLLDVFFTFNIALSIVVL
LVCVYALRPLDFAVFPTILLVATLLRLALNVASTRVVMLHGQDGHAAAGKVIQAFGEVVI
GGNYVVGIVVFAILMIINFVVVTKGAGRISEVSARFTLDAMPGKQMAIDADLNAGLIDQG
QAKLRRLEVAQEAEFYGSMDGASKFVRGDAIAGLLILFINLIGGMAVGIFQHNMTFGDAG
KVYALLTIGDGLVAQLPSLLLSTAAAIMVTRASGSEDMGKQIGRQMFASPKALAVAAGLM
AVMGLVPGMPHISFLTMAAAAAGGAYLFWKKQNAQKVQALQEVKRQQELLPSPARAMETK
ELGWDDVTPIDMIGLEVGYRLIPLVDRNQGGQLLARIKGVRKKLSQDLGFLMPTVHIRDN
LDLAPSAYRLTLMGVILAEAEIYPDRELAINPGQVYGSLNGITAKDPAFGLEAVWIEISQ
RAQAQSLGYTVVDASTVVATHLNQILYKHSSELIGHEEVQQLLQVLAKGSPKLAEELVPG
VVSLSQLLKVLQALLAEQVPVRDIRSIAEAIANNASKSQDTAALVAAVRVGVSRAIVQSI
VGTESELPVITLEPRLEQILLNSLQKAGQGSEEGVLLEPSMAEKLQRSLIEAAQRQEMQG
QPVILLVAGPIRAMLSRFGRLAVPGLHVLAYQEIPDNKQVTIVATVGPNG