Protein Info for Pf6N2E2_2575 in Pseudomonas fluorescens FW300-N2E2

Annotation: Flagellar biosynthesis protein FlhF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 TIGR03499: flagellar biosynthesis protein FlhF" amino acids 1 to 317 (317 residues), 245.7 bits, see alignment E=4.7e-77 PF00448: SRP54" amino acids 231 to 419 (189 residues), 159.6 bits, see alignment E=3.8e-51

Best Hits

Swiss-Prot: 82% identical to FLHF_PSEPU: Flagellar biosynthesis protein FlhF (flhF) from Pseudomonas putida

KEGG orthology group: K02404, flagellar biosynthesis protein FlhF (inferred from 100% identity to pba:PSEBR_a1496)

Predicted SEED Role

"Flagellar biosynthesis protein FlhF" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXP2 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Pf6N2E2_2575 Flagellar biosynthesis protein FlhF (Pseudomonas fluorescens FW300-N2E2)
MQVKRFFAADMRQAMKLVRDELGAEAAIIGNRRIAGGVELTAALDYKLSALAPRVPNMEL
EDELRKTQSRIASAQAELSLRSSEGEGAAGTNRQLFAGQPLTAGLPLTAAEPLIEQAHAE
PRRPEPAPAAPARGVDPRALDSMRFELNSLRELMEVQLGSLAWNQLQGSRPAQANLWRRL
QRIGLSGPLSRDLLALINDIEEPRQAWRMLLAHLARMIATPEVEPLEEGGVIAMVGPAGM
GKTTTLAKLAARYVLKYGAQSIALVSMDSFRIGAQEQLKTLGRILNVSVTHVDPGQSLAQ
ALEPLLRKRVVLIDTAGLQASDPALRMQLESLAGRGIKSKNYLVLATTSQKQVLTAAYHS
YKRCGLAGCILTKLDETASLGEVLSLAIGHELPVAYLTDGPRIPDDLHLPRRHQLVSRAV
SVQMQEEPSEEAMADMFADIYHSPTKQVG