Protein Info for Pf6N2E2_2523 in Pseudomonas fluorescens FW300-N2E2

Annotation: Methylthioribose-1-phosphate isomerase (EC 5.3.1.23)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 TIGR00512: S-methyl-5-thioribose-1-phosphate isomerase" amino acids 2 to 331 (330 residues), 418.6 bits, see alignment E=1.6e-129 TIGR00524: eIF-2B alpha/beta/delta-related uncharacterized proteins" amino acids 31 to 331 (301 residues), 325.1 bits, see alignment E=4.1e-101 PF01008: IF-2B" amino acids 43 to 331 (289 residues), 251.1 bits, see alignment E=6.3e-79

Best Hits

Swiss-Prot: 86% identical to MTNA_PSEPF: Methylthioribose-1-phosphate isomerase (mtnA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K08963, methylthioribose-1-phosphate isomerase [EC: 5.3.1.23] (inferred from 94% identity to pba:PSEBR_a1547)

Predicted SEED Role

"Methylthioribose-1-phosphate isomerase (EC 5.3.1.23)" in subsystem Methionine Salvage (EC 5.3.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVY0 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Pf6N2E2_2523 Methylthioribose-1-phosphate isomerase (EC 5.3.1.23) (Pseudomonas fluorescens FW300-N2E2)
VKAIDWRDGVLYLLDLRVLPSEENWIACTCAADVAEAIGSLVVRGAQAIGISAAYGVVLA
ARTRVAEGGDWQSALEADFALLAEARPTAANLFWALDRMRDRLGRLKEHAEPLAVLEAEA
IAIHESDREANLTMTQLGVDLIRKHQGNAQAILTHGNTGALASGGFGTALGVIRGAYIEG
MVERVYADETRPSLQGSRLTAWELARESIPVTLNADSAAAHIMKTKGVTWVIVGADCITA
NGDVANKIGTYQLAVCAMHHGVRFMVVAPSSTIDMSLACGDDVPVEERDGRELLEIGGKR
LGGEVEAFNPTFDITPADLIDVIVTEKGIIERPDTAKLAQLMCRKRLH