Protein Info for Pf6N2E2_2510 in Pseudomonas fluorescens FW300-N2E2

Annotation: Lipid carrier : UDP-N-acetylgalactosaminyltransferase (EC 2.4.1.-) / Alpha-1,3-N-acetylgalactosamine transferase PglA (EC 2.4.1.-); Putative glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13477: Glyco_trans_4_2
  • amino acids 4 to 131 (128 residues), 43.3 bits, E=1e-14
• PF20706: GT4-conflict
  • amino acids 180 to 312 (133 residues), 34.6 bits, E=2.8e-12
• PF00534: Glycos_transf_1
  • amino acids 194 to 351 (158 residues), 135.3 bits, E=4e-43
• PF13692: Glyco_trans_1_4
  • amino acids 196 to 337 (142 residues), 120.3 bits, E=2e-38
• PF13524: Glyco_trans_1_2
  • amino acids 255 to 362 (108 residues), 35.4 bits, E=2.4e-12

Best Hits

KEGG orthology group: None (inferred from 54% identity to pag:PLES_19151)

MetaCyc: 33% identical to UDP-GalNAc:alpha-D-GlcNAc-PP-Und alpha-(1,3)-GalNACtransferase (Salmonella enterica enterica serovar Poona)
2.4.1.-

Predicted SEED Role

"Lipid carrier : UDP-N-acetylgalactosaminyltransferase (EC 2.4.1.-) / Alpha-1,3-N-acetylgalactosamine transferase PglA (EC 2.4.1.-); Putative glycosyltransferase" in subsystem N-linked Glycosylation in Bacteria (EC 2.4.1.-)

MetaCyc Pathways

• Salmonella enterica serotype O:13 O antigen biosynthesis (2/6 steps found)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

See A0A159ZZP9 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Pf6N2E2_2510 Lipid carrier : UDP-N-acetylgalactosaminyltransferase (EC 2.4.1.-) / Alpha-1,3-N-acetylgalactosamine transferase PglA (EC 2.4.1.-); Putative glycosyltransferase (Pseudomonas fluorescens FW300-N2E2)
MSRILLIVVNDPRYFLSHRLPIAKAAQGKGYAVHVASIASPLSGKVIEEGFIYHTIKLER
GGINPLLEFFAMISFVRLLWRLRPTLLHLVTTKPVLYGGMAARLAPVGGVVSAIAGMGSV
FIGRDLRSKVLSFVLSRMYRLALGAHNLRAIFQNPCDRALVMKMSGLDADKTVLIRGSGV
HLASYPVLPEPIGTITVTFAGRFLRDKGVHEFIKAAQLVKRRQNDVVFQLVGDVDEGNPT
SLSSTEVEALTVEGNVRVLGYQSDLAKIFSRSHIVVLPSYREGLPKVLIEAAACARPVVT
SDVPGCRDAIIAGETGLLVPVKDAEALAIAIEKLVSNAELRHEMGRAGRKWAEREFAIEN
VVKVHLDVYQALEAET