Protein Info for Pf6N2E2_2499 in Pseudomonas fluorescens FW300-N2E2

Annotation: Competence protein ComEA helix-hairpin-helix region precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR00426: competence protein ComEA helix-hairpin-helix repeat region" amino acids 45 to 108 (64 residues), 83.2 bits, see alignment E=5.4e-28 PF12836: HHH_3" amino acids 46 to 108 (63 residues), 76.4 bits, see alignment E=1.4e-25

Best Hits

KEGG orthology group: K02237, competence protein ComEA (inferred from 96% identity to pba:PSEBR_a1576)

Predicted SEED Role

"Competence protein ComEA helix-hairpin-helix region precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXI2 at UniProt or InterPro

Protein Sequence (111 amino acids)

>Pf6N2E2_2499 Competence protein ComEA helix-hairpin-helix region precursor (Pseudomonas fluorescens FW300-N2E2)
MRTGYFYSLVFAFLTSASIAAIAAPVVKPEVVATPQAVEQPAKTQSTKVDLNGADAATLQ
RELSGIGKGKAEAIVAYRENNGPFSSVEELLEVKGIGKAILDRNRDKLEVN