Protein Info for Pf6N2E2_2484 in Pseudomonas fluorescens FW300-N2E2

Annotation: Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details PF00672: HAMP" amino acids 160 to 208 (49 residues), 35.5 bits, see alignment 1e-12 PF00015: MCPsignal" amino acids 304 to 460 (157 residues), 145.7 bits, see alignment E=1.3e-46

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a1596)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXR5 at UniProt or InterPro

Protein Sequence (493 amino acids)

>Pf6N2E2_2484 Methyl-accepting chemotaxis protein I (serine chemoreceptor protein) (Pseudomonas fluorescens FW300-N2E2)
MGAWLSNISLKYKFWAVNAVAFVTTLLLVLYAVHLEQQARNHAAQANAQAQAHLLDAWPA
GTPLPKVDYLLAFPRDQVPVLNEQPLPSLAQANGWVELDTGLLFGDNPLLGAQVIHRGES
QRLAVLAQGVSLSQVFGERFSQYAAAVFVLMLAMLGASQLLIRFLLSQLNTLKDVMLHVE
KTGDLSARVPLACEDEVGQMAAAFNAMQAGYQRVVDTVASTARQLDSGAARLASSMNDVR
HGMLGQQSETDQAATAINEMSATVYHIAQHAGATRDLSKTADTLAGNGHDVVARVQQSIT
GLSSGVQQTAEMIQRLAEDSQKINGVVSVIHSIAEQTNLLALNAAIEAARAGEMGRGFAV
VADEVRNLAKRVQTSTDEITTMVSALQAGTRDAVDFMQESSLKADDCVQQAREAGDALAQ
ITAAVAQMRESNTQIAVAAEQQSHVAEEMNRAVVSIRDVTENTVRQTVDSATTSHELATL
AGELSKAIGQLKL