Protein Info for Pf6N2E2_246 in Pseudomonas fluorescens FW300-N2E2

Annotation: Methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 647 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 292 to 318 (27 residues), see Phobius details signal peptide" amino acids 30 to 30 (1 residues), see Phobius details PF02743: dCache_1" amino acids 48 to 277 (230 residues), 82.9 bits, see alignment E=5.5e-27 PF22673: MCP-like_PDC_1" amino acids 132 to 199 (68 residues), 28.8 bits, see alignment E=2.9e-10 PF00672: HAMP" amino acids 315 to 365 (51 residues), 32.4 bits, see alignment 1.8e-11 PF00015: MCPsignal" amino acids 458 to 612 (155 residues), 147.5 bits, see alignment E=7.3e-47

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 97% identity to pba:PSEBR_a3621)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YP83 at UniProt or InterPro

Protein Sequence (647 amino acids)

>Pf6N2E2_246 Methyl-accepting chemotaxis protein (Pseudomonas fluorescens FW300-N2E2)
MNIKQKLTWAFAAIACLPVILVAVLVVLNLRDAAKANFLDSSGREIRQIDNGMKQFFDGI
SQNVEFFAKDPRVIAAKGLKSYAGADAAQQPFPEINQQLLDIFERFAKSHPTTAYLSVGM
EDGGYASWPDDPKMANYDPRVRPWYKAAMAAPGTNVRTDAYYWAPDDVSLIGTVHTVADA
SGKPIGVVGLDVSLKQLTELVKNIKLGESGYLMLVEANGNVLVDPADAKHNFKPLADLGP
NYAELAKSSDGVTQIEIDGVPYMANVVSSKGLGWRFIGLIKRDEVMAEASSLTWLIAAIA
AVLAVVFALVGASFASVIVRPIRGVANGLQEIAEGEGDLTRKLTVQGKDETATLAGWFNQ
FLGMIAQLMQRIGSASSDLQTAAADTSHVAQNMNDAAGRQRQAVELVSTAFNEMVATANE
VARSCSQAASSADEGYRDVHDGQHHIGEATGSVMKLSDDLQKSTQTMQALEQDSKNINTI
LDTIRSIAEQTNLLALNAAIEAARAGDQGRGFAVVADEVRALARRTADSTGEIDSLLGNL
ARRTQEVTQQMQSSLQVSQTSVERIQQARDSFDKIRNSVDSIRDQNTQIATAAEEQHQVA
EDINRHIAQIHADAQLVEEFAHSAQTGSGRLTDISGQLKGLVGRFRF