Protein Info for Pf6N2E2_2457 in Pseudomonas fluorescens FW300-N2E2

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 7 to 37 (31 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 136 to 161 (26 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details PF01925: TauE" amino acids 8 to 244 (237 residues), 158 bits, see alignment E=1.7e-50

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 98% identity to pba:PSEBR_a1619)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXE9 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Pf6N2E2_2457 putative membrane protein (Pseudomonas fluorescens FW300-N2E2)
VFEFALFLVFGAVLGTLGGLFGIGGGLIAIPVLGVWFGLDQQMAQGTALVMVVPNVMLAL
WRYHQRNRIELRHVLPLASMGFCFAWLGSIWAVGIDANSMRIGFVAFLIALTLYNMARMF
AANAPASAQMRYGWPWLAVLGAASGTMGGLFGVGGAVVATPILTSIFGTSQVVAQGLSLA
LALPSTGVTLATYAFHHEVDWSIGLPLAVGGLLSISWGVKVAHALPERLLRGLFCGFLVL
CAVLLAFKV