Protein Info for Pf6N2E2_2442 in Pseudomonas fluorescens FW300-N2E2

Annotation: sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 773 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details PF00512: HisKA" amino acids 291 to 356 (66 residues), 69.6 bits, see alignment E=2.9e-23 PF02518: HATPase_c" amino acids 402 to 511 (110 residues), 93.1 bits, see alignment E=2.3e-30 PF00072: Response_reg" amino acids 652 to 763 (112 residues), 100.2 bits, see alignment E=1.2e-32

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a1633)

Predicted SEED Role

"sensor histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZX66 at UniProt or InterPro

Protein Sequence (773 amino acids)

>Pf6N2E2_2442 sensor histidine kinase/response regulator (Pseudomonas fluorescens FW300-N2E2)
MDIRFTQRLSYKQARLTVLVGFVLGTLLSLMQIGIDYASEDASINREILSLLEISHNPAS
RIAYNIDAELAQELSMGLLRSPAIIGAELIDNNNTVLASVKRPELQSSYRFISDFLFGAQ
RQFEDRLYLDHLPNESLGMLRLDVDTYAFGSRFLRRAEVTLLNGFARSLILTGLLLALFY
VMLTKPLVRVIRELSSRDPSSNEQNRLECPAGHQSDEIGVLVSVANQQFENISTEIQQRR
TAENRLTEYLAQLENIVSARTAELKASNARLSQSNEELEVARRTALDMAEARSAFLANMS
HEIRTPLNGLLGMIALSLDGPLTAEQQQQLSIAHDSGKVLVELLNDILDLSKFDAGQLEL
ERIPFDLGSLVEDTANLLSQNAAPSVELACLIKPQFPAQVLGDPTRVRQIVSNLLSNALK
FTRFGRVDVKLSHYEGGVRIEVCDTGIGIPQEAQARILQPFTQAGAGITRQFGGTGLGLA
LTYNLCEAMQGRLTISSEAGFGSQFCADLPLPCHLPATPVEPLRGNVVAITASSSGLAEL
LGMLLPGWGLDYVQRSIDDGLLGLKPDMLITDCPECLFNLRPTFDAPILLVTAYGSFMPS
EEAAALAPLIQQARPLARLALYQILRRAMQSEATVIDDAQIETLAPSRRGRVLLVEDNPV
NQLVAKGMLVKLGCEVTVAAHGAEALSQLEQRVFDLVLMDCNMPVMDGYEASRQIRQSGR
WSDLPIVALTANAMPEERERCRAAGMNDYLSKPFRREELAAVLDQWVPTTSAL