Protein Info for Pf6N2E2_2430 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ammonium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 197 to 221 (25 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details amino acids 316 to 338 (23 residues), see Phobius details amino acids 349 to 372 (24 residues), see Phobius details PF00909: Ammonium_transp" amino acids 19 to 395 (377 residues), 293.9 bits, see alignment E=8.7e-92

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a1642)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZX59 at UniProt or InterPro

Protein Sequence (402 amino acids)

>Pf6N2E2_2430 Ammonium transporter (Pseudomonas fluorescens FW300-N2E2)
MENMQNAVDGLVHSSNTLFILLGAVMVLAMHAGFAFLEVGTVRQKNQVNALSKILSDFAV
STLAYFFIGYWIAYGVTFLQPAAVLSADHGYSLVKFFFLLTFAAAIPAIISGGIAERARF
APQLCATVLIVAFVYPFFEGMIWNGNFGLQAWLQARFGASFHDFAGSVVVHAMGGWLALA
AVLLLGPRNGRYRDGRLVAFAPSSIPFLALGSWILIVGWFGFNVMSAQTLPGVSGLVAVN
SLMAMVGGTVAALIVGRNDPGFLHNGPLAGLVAVCAGSDLMHPVGALVTGAIAGALFVWC
FTAAQGKWKIDDVLGVWPLHGLCGVWGGIACGVFGQSALGGLGGVSLVSQLIGTALGVVV
ALAGGFAVYGMVRVVLGLRLTQEEEYYGADLSIHKIGAVSQD