Protein Info for Pf6N2E2_2429 in Pseudomonas fluorescens FW300-N2E2

Annotation: Glutathione-regulated potassium-efflux system protein KefB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 27 to 42 (16 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 173 to 199 (27 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 291 to 313 (23 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 10 to 281 (272 residues), 240.2 bits, see alignment E=1.5e-75 PF00999: Na_H_Exchanger" amino acids 10 to 370 (361 residues), 217.6 bits, see alignment E=2.5e-68 PF02254: TrkA_N" amino acids 405 to 518 (114 residues), 72.7 bits, see alignment E=3.2e-24

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 99% identity to pba:PSEBR_a1643)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein KefB" in subsystem Glutathione-regulated potassium-efflux system and associated functions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXM9 at UniProt or InterPro

Protein Sequence (570 amino acids)

>Pf6N2E2_2429 Glutathione-regulated potassium-efflux system protein KefB (Pseudomonas fluorescens FW300-N2E2)
LFANLLIILASSLVVIALFRRLRLPPVLGYLCVGLAVGPTALDWVNDSEELPDLAELGVV
FLLFSLGLEFSLSKMLELRRVVFGLGSLQVLCSGAVLAGLLALAGAPVIAALLLGAGLAL
SSTAIVSKELTSLGEIFSSHGQNAIGVLLFQDVVAVLLLTLVPVFAGSSDHPWYWALPLT
LGKTLVLFGGLLLASRLLLPRLFHEVAASRSAELFVLLALVIVLLTAWLTHLLGLSPALG
AFLAGMLLGESHYRHQIEADIRPFRDILLGLFFVSIGMLIDLQLFLDDGLLILGLTIGLM
LIKGCVVAVLVKWRGSDVETAWRSGLALAQGGEFCFALMALMQQNRLMPADISGLLLAAT
FCSMLLTPLLLRAAPRIAARLHRKPNEEAQLDQISALNAGLSGHVVICGYGRVGQSIGRF
LRREGQAFVALDDDPVIIQEATVGENCVHYGDSRRGDLLAAVGLSRARLLVIAVDKTDIA
ITVLKAARQVNHQVPILVRTRDDSQLAELQAAGASEVVPELLESSLMLASHALIMLGLPE
QQVRHHVDQVRHDRYRLLHGFYPGNQDKEP