Protein Info for Pf6N2E2_232 in Pseudomonas fluorescens FW300-N2E2

Annotation: Protein involved in meta-pathway of phenol degradation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13557: Phenol_MetA_deg" amino acids 69 to 318 (250 residues), 184.9 bits, see alignment E=1.4e-58

Best Hits

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a3640)

Predicted SEED Role

"Protein involved in meta-pathway of phenol degradation" in subsystem Phenylpropanoid compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YNT7 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Pf6N2E2_232 Protein involved in meta-pathway of phenol degradation (Pseudomonas fluorescens FW300-N2E2)
MSLTKSLPACLALSFASFAAHAADGPPPPSVSQPSGINLGGTSFYDGFAGPPGLTHQTYL
KFSTASSIRTNGGKKNGAFDDPKINVITMINQLSYYSPDTFAGGAHLGWSLLVPVVSLDG
DFGDNGAKLKDNATGLGDVTVGPQVQFDPIVDASGRPVFVQRMAFDTILPTGKYDKDKDL
NPGSNHFSLNPYWAATWMPAPRWEVSWRLNYLYNFKNDDPASSSQQFFEGQAVRDTQSGQ
SAWANFTASYEVFPKVSVGINGYYFRQISDDKVNGNTLTDSREKVLGFGPGLFWKITEDK
AFWLNTYKETGVENRSRADYQVQVRYVHKF