Protein Info for Pf6N2E2_2300 in Pseudomonas fluorescens FW300-N2E2

Annotation: LSU rRNA 2'-O-methyl-C2498 methyltransferase RlmM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF18125: RlmM_FDX" amino acids 1 to 70 (70 residues), 71.5 bits, see alignment E=1e-23 PF21239: RLMM_N" amino acids 82 to 157 (76 residues), 61.7 bits, see alignment E=8.4e-21 PF01728: FtsJ" amino acids 181 to 274 (94 residues), 38.5 bits, see alignment E=1.8e-13

Best Hits

Swiss-Prot: 93% identical to RLMM_PSEPF: Ribosomal RNA large subunit methyltransferase M (rlmM) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K06968, ribosomal RNA large subunit methyltransferase M [EC: 2.1.1.-] (inferred from 98% identity to pba:PSEBR_a1736)

Predicted SEED Role

"LSU rRNA 2'-O-methyl-C2498 methyltransferase RlmM"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZ75 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Pf6N2E2_2300 LSU rRNA 2'-O-methyl-C2498 methyltransferase RlmM (Pseudomonas fluorescens FW300-N2E2)
MNTLFMHCRPGFEGEVCSEIAEHAARLNVAGYAKAKPASACAEFVCTEEDGAERLMGGLR
FAELIFPRQWARGTFIDLPETDRISVILAHMAAFPTCGSLWLEVVDTNDGKELSNFCKKF
EGPLRKALIGAGKLVDDPRKPRLLLTFKSGREVFLGLAESDNSAMWPMGIPRLKFPREAP
SRSTLKLEEAWHHFIPRDQWDERLHSDMTGVDLGAAPGGWTWQLVNRGMLVTAIDNGPMA
ESLMDTGLVQHLMADGFTFKPKQPVDWMVCDIVEKPARNAAMLEEWIGEGHCREAVVNLK
LPMKQRYAEVKRLLERIADGFKARGIKVEIGCKQLYHDREEVTCHLRRLDTKKPKSR