Protein Info for Pf6N2E2_2242 in Pseudomonas fluorescens FW300-N2E2

Annotation: tyrosine phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 PF00583: Acetyltransf_1" amino acids 29 to 104 (76 residues), 27.8 bits, see alignment E=2.7e-10 PF13508: Acetyltransf_7" amino acids 32 to 110 (79 residues), 33.3 bits, see alignment E=5.1e-12

Best Hits

KEGG orthology group: K00619, amino-acid N-acetyltransferase [EC: 2.3.1.1] (inferred from 91% identity to pba:PSEBR_a1793)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZ39 at UniProt or InterPro

Protein Sequence (143 amino acids)

>Pf6N2E2_2242 tyrosine phosphatase (Pseudomonas fluorescens FW300-N2E2)
MRMIVLSNNDLGPLRDALTLAGLPIDDLAYPGRQFFSFSDQDVVVAFGGIEGEGADRLLR
SLVVLEGQRGKGVGAAVLAAIEAFAKREAVGQLHLLTDSAAAFFTGQGYQARDRSLAPAS
IGATAQFKTLCPASATYLGKRLV