Protein Info for Pf6N2E2_2233 in Pseudomonas fluorescens FW300-N2E2

Annotation: Shikimate 5-dehydrogenase I gamma (EC 1.1.1.25)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF08501: Shikimate_dh_N" amino acids 26 to 93 (68 residues), 60 bits, see alignment E=1.1e-20

Best Hits

Swiss-Prot: 55% identical to SHDHL_HAEIN: Shikimate dehydrogenase-like protein HI_0607 (sdhL) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 98% identity to pba:PSEBR_a1801)

Predicted SEED Role

"Shikimate 5-dehydrogenase I gamma (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z792 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Pf6N2E2_2233 Shikimate 5-dehydrogenase I gamma (EC 1.1.1.25) (Pseudomonas fluorescens FW300-N2E2)
MQINPNKDTQLCMSLSGRPGNFGLRFHNHLYEQLGLNFYYKAFSSQDLPGAVGGIRALGI
RGCGVSMPFKEACIALVDELDPSAAAIESINTIVNTNGHLKAYNTDYIAIAQLLQSHAVP
KDSTFALRGSGGMAKAVASALRDGGYQNGLIVARNEAAGRALAESLGYEWQADLGTRRPQ
MLINVTPIGMTGGPEADQLAFEPETIVAAETVFDVVAIPSETPLIVRARAEGKRVITGLE
VIAIQALEQFVLYTGVRPNLEQFEKTVTFARSA