Protein Info for Pf6N2E2_2232 in Pseudomonas fluorescens FW300-N2E2

Annotation: Virulence factor mviM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF04337: DUF480" amino acids 14 to 158 (145 residues), 179.2 bits, see alignment E=2.8e-57

Best Hits

Swiss-Prot: 86% identical to Y2135_PSEFS: UPF0502 protein PFLU_2135 (PFLU_2135) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K09915, hypothetical protein (inferred from 98% identity to pba:PSEBR_a1802)

Predicted SEED Role

"Virulence factor mviM"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZ31 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Pf6N2E2_2232 Virulence factor mviM (Pseudomonas fluorescens FW300-N2E2)
MSIEEQQQAEEPRLNSTEIRILGALVEKQATNPETYPLTLNALVLACNQKTSREPVMNLN
PGQVGQSLRALEGRGFTKLVMGSRADRWEHRVDKALELVPAQVVLMGLLFLRGPQTVNEL
LTRSGRMHDFEDAEQVVHQLERLIARGLALLVPRQAGQREDRYVHAMGDPADIEAILAAR
QHPLERGAGSAVSLERIEELEARIAALEERLSRLE