Protein Info for Pf6N2E2_2034 in Pseudomonas fluorescens FW300-N2E2

Annotation: Methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF01209: Ubie_methyltran" amino acids 39 to 148 (110 residues), 49.1 bits, see alignment E=1.5e-16 PF13489: Methyltransf_23" amino acids 44 to 205 (162 residues), 53.2 bits, see alignment E=9.2e-18 PF13847: Methyltransf_31" amino acids 47 to 148 (102 residues), 63.2 bits, see alignment E=7.5e-21 PF13649: Methyltransf_25" amino acids 50 to 144 (95 residues), 72.2 bits, see alignment E=1.5e-23 PF08242: Methyltransf_12" amino acids 51 to 146 (96 residues), 49.7 bits, see alignment E=1.6e-16 PF08241: Methyltransf_11" amino acids 51 to 148 (98 residues), 75.7 bits, see alignment E=1.1e-24

Best Hits

KEGG orthology group: None (inferred from 87% identity to pfo:Pfl01_3054)

Predicted SEED Role

"Methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z5V0 at UniProt or InterPro

Protein Sequence (287 amino acids)

>Pf6N2E2_2034 Methyltransferase (Pseudomonas fluorescens FW300-N2E2)
MTEQKAYQVADWNGQSGEYWAANQARLDAMFAVFGQAAIEAAAPAMGERVLDVGCGAGAS
SLELAGRVGAGGHVLGVDISEPLIGRARALAPQDTPAQFRVADASSAELPEGAFDILFSR
FGVMFFDDPTGAFTHMRRALRPGGRVAFVCWRGVAENDWLRLPMGAIKDIVPLPAPPGPE
APGPFSFGDRGRVTRILTAAGFTDIALTPFDAAIPFGEGGTRDAAIDDAVKMAFEGGPLS
LVLADQSDDIRARAWAAVRAAFAGLPGERSVMIDGAAWIVTARNPAS