Protein Info for Pf6N2E2_2025 in Pseudomonas fluorescens FW300-N2E2

Annotation: 2-keto-3-deoxy-D-arabino-heptulosonate-7- phosphate synthase I alpha (EC 2.5.1.54)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR00034: 3-deoxy-7-phosphoheptulonate synthase" amino acids 24 to 352 (329 residues), 439.9 bits, see alignment E=2.5e-136 PF00793: DAHP_synth_1" amino acids 50 to 345 (296 residues), 260.9 bits, see alignment E=5e-82

Best Hits

Swiss-Prot: 55% identical to AROF_ECOLI: Phospho-2-dehydro-3-deoxyheptonate aldolase, Tyr-sensitive (aroF) from Escherichia coli (strain K12)

KEGG orthology group: K01626, 3-deoxy-7-phosphoheptulonate synthase [EC: 2.5.1.54] (inferred from 98% identity to pba:PSEBR_a1981)

MetaCyc: 55% identical to 3-deoxy-7-phosphoheptulonate synthase, Tyr-sensitive (Escherichia coli K-12 substr. MG1655)
3-deoxy-7-phosphoheptulonate synthase. [EC: 2.5.1.54]

Predicted SEED Role

"2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate synthase I alpha (EC 2.5.1.54)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.54

Use Curated BLAST to search for 2.5.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZW92 at UniProt or InterPro

Protein Sequence (356 amino acids)

>Pf6N2E2_2025 2-keto-3-deoxy-D-arabino-heptulosonate-7- phosphate synthase I alpha (EC 2.5.1.54) (Pseudomonas fluorescens FW300-N2E2)
MNSSVSALPLSTLNPANEALTLRLPSSLQLKHQLPLSTALSHQVSVHRQAIRAILNGEDA
RLLVIVGPCSIHDPKSALEYATNLARVAHEVSDSMLLVMRAYVEKPRTTVGWKGLAYDPG
LDGSDDMAAGLTLSRELMREMLQLGLPVATELLQPMAASYFDDLLSWVAIGARTTESQIH
REMASGLGMPVGFKNGTDGGVGIACDAMRSAAHPHRHFGVDSQGHPAIIQTPGNPDTHLV
LRGGHRGPNYDQQSVTQIHHDLTRLKIPARIMVDCSHANSGKDPLRQPQVFNDVLEQRLQ
GNRALIGMMLESHLFEGCQPLGPSMRYGVSVTDGCLGWESTERLLREAHRKLQLPA