Protein Info for Pf6N2E2_2022 in Pseudomonas fluorescens FW300-N2E2

Annotation: BarA-associated response regulator UvrY (= GacA = SirA)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 PF00072: Response_reg" amino acids 5 to 97 (93 residues), 73.1 bits, see alignment E=2.1e-24 PF00196: GerE" amino acids 129 to 184 (56 residues), 48.7 bits, see alignment E=4.8e-17

Best Hits

Swiss-Prot: 97% identical to GACA_PSEPH: Response regulator GacA (gacA) from Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CHA0)

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a1984)

Predicted SEED Role

"BarA-associated response regulator UvrY (= GacA = SirA)" in subsystem Pseudomonas quinolone signal PQS or Quorum sensing regulation in Pseudomonas or Type III secretion system orphans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WS37 at UniProt or InterPro

Protein Sequence (194 amino acids)

>Pf6N2E2_2022 BarA-associated response regulator UvrY (= GacA = SirA) (Pseudomonas fluorescens FW300-N2E2)
MLADIDGLQVVGQAESGEESLIKARELKPDVVLMDVKMPGIGGLEATRKLLRSHPDIKVV
AVTVCEEDPFPTRLLQAGAAGYLTKGAGLNEMVQAIRLVFAGQRYISPQIAQQLAIKSFQ
PTNDSPFDALSEREIQIALMIVGCQKVQIISDKLCLSPKTVNTYRYRIFEKLSISSDVEL
TLLAVRHGMVDASA