Protein Info for Pf6N2E2_2000 in Pseudomonas fluorescens FW300-N2E2

Annotation: Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 613 TIGR03760: integrating conjugative element relaxase, PFGI-1 class" amino acids 26 to 242 (217 residues), 265.9 bits, see alignment E=1.4e-83 PF07514: TraI_2" amino acids 26 to 339 (314 residues), 393.8 bits, see alignment E=5.2e-122 PF07515: TraI_2_C" amino acids 473 to 596 (124 residues), 157.2 bits, see alignment E=2.1e-50

Best Hits

KEGG orthology group: None (inferred from 60% identity to tgr:Tgr7_2872)

Predicted SEED Role

"Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161HA09 at UniProt or InterPro

Protein Sequence (613 amino acids)

>Pf6N2E2_2000 Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes (Pseudomonas fluorescens FW300-N2E2)
MFSLFHRKSRPAPKHIDPTEPTAPAGLTRPQSAKSLLATPRREKLLKLIWQHTAVSRPQF
NEIYLDPINRYAELVQLLPASESHHHAYPGGMLDHGLEVVIYALKLRQSYLLPSGAQPEV
QIIQAEAWTAALVYAALGHDLGKIAVDVHVEYGDGRVWHPWQGPLSAPYRARYKKNRQYR
LHGIVAGVLIHKILNSEIMDWLSTFPELWTALMFNCAGQNEHAGELGILISKADQASVAQ
ALGGDPTKAMAAPKHALQRKLLEGLRYLLSEELKLNQPQASDGWLTQEALWLVSKTVSDK
LRAHLLSQGVDGIPEQNIAIFNVLQEHGIALPNTNGKAIWKATVTSETGWSHSFTFLKLS
PAMIWDREERPDAFTGSVAVIPLESATTLSDDASIHHQAPPSARESSVGSLMPPTPPSNS
IAMDSSAPNSLDSLMDLFGGPPALPEDFAPPLEETDHSPSDASPQGSKPVKLSGAHFMEW
LTNGLRSHRIIMNDANALVHTVSDTLYLVTPGVFLRYAQEHPHLARIAKKEKLLDWEWIQ
KRFEELKLHRKQPNDLNIWICEVSGARKTRRLYGYLLKSHEGLMNDLALNNPYLKLLDSM
PRKRKTPTLGNTR