Protein Info for Pf6N2E2_2 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG057993:Thioesterase involved in non-ribosomal peptide biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF00975: Thioesterase" amino acids 5 to 230 (226 residues), 151.5 bits, see alignment E=4.5e-48 PF12697: Abhydrolase_6" amino acids 35 to 224 (190 residues), 35.5 bits, see alignment E=1.8e-12

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a3923)

MetaCyc: 38% identical to N-acetyldemethylphosphinothricinyl-transferase (Streptomyces viridochromogenes)
2.3.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YGD1 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Pf6N2E2_2 FIG057993:Thioesterase involved in non-ribosomal peptide biosynthesis (Pseudomonas fluorescens FW300-N2E2)
VTQLTLLCLPYSGASAMVYSRWRRTLPQWLHVQPVELPGRGARFDEPLHTDMGPLAMQLA
RELSATLQAPYALFGHSLGALLACEIAHALRELGCPEPVALFASGTAAPTMRADYDRGFA
EPKTDAELIEQLRTLNGTSEEILANEELMALTLPVLRADFLLCGRFQPRIRPPLNCPVHV
LGGAADKATTEQLIGWRRETTGSFSVDMLAGGHFFIHEHEAKVLRLIKDQLSVHHRRHGL
AISA