Protein Info for Pf6N2E2_19 in Pseudomonas fluorescens FW300-N2E2

Annotation: Pyoverdine efflux carrier and ATP binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 656 transmembrane" amino acids 284 to 304 (21 residues), see Phobius details amino acids 532 to 556 (25 residues), see Phobius details amino acids 584 to 610 (27 residues), see Phobius details amino acids 616 to 639 (24 residues), see Phobius details PF00005: ABC_tran" amino acids 26 to 174 (149 residues), 111.3 bits, see alignment E=8.5e-36 PF12704: MacB_PCD" amino acids 283 to 499 (217 residues), 153.8 bits, see alignment E=1.2e-48 PF02687: FtsX" amino acids 537 to 649 (113 residues), 67 bits, see alignment E=2.4e-22

Best Hits

Swiss-Prot: 83% identical to MACB1_PSEPF: Macrolide export ATP-binding/permease protein MacB 1 (macB1) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K05685, macrolide transport system ATP-binding/permease protein [EC: 3.6.3.-] (inferred from 96% identity to pba:PSEBR_a3909)

Predicted SEED Role

"Pyoverdine efflux carrier and ATP binding protein" in subsystem Siderophore Pyoverdine

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YGU9 at UniProt or InterPro

Protein Sequence (656 amino acids)

>Pf6N2E2_19 Pyoverdine efflux carrier and ATP binding protein (Pseudomonas fluorescens FW300-N2E2)
MNTPLIELRDIRKAYGGGDSPRVEVLRGIDLSIHAGEFLAIVGASGSGKSTLMNILGCLD
RPTSGEYRFAGEDVANLGSDELAWLRREAFGFVFQGYHLIPSGTAQENVEMPAIYAGTSA
AERHARASALLDRLGLASRTGNRPHQLSGGQQQRVSIARALMNGGHIILADEPTGALDSQ
SGIEVMALLDELASQGHVVILITHDREVAARAKRIIEIRDGLIISDNAPSSPHEVHANPK
ALQAVDLRQRLSAGSEHNGAWKGELLDAVQAAWRVMWINRFRTALTLLGIIIGVASVVVM
LAVGEGSKRQVMAQMGAFGSNIIYLNGSAPSPRAAKGIISEYDLAALAALPEVQRIMPVN
GADASVRFGNLDHTSYVGGNDTNFPIIFNWPVAQGSYFSEADERSAAAVAVIGYRVRQKL
FKDVADPVGRYILIENMPFQVVGVLAEKGASSGDSDADDRVAVPYSAASVRLFGSRHPEY
VVIAAKDAGKVKEAEQAVSRTLLRLHDGKKDFELTNNAAMIQAEARTQGTLSLMLGAIAA
ISLLVGGIGVMNIMLMTVRERTREIGIRMATGARQRDILRQFLTEAVMLSVVGGLAGIGL
ALLVGGALLLGKIAVAFEWLAVFGAFGCALVTGVVFGFMPARKAARLDPVAALTSE