Protein Info for Pf6N2E2_1846 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG002465: BNR repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details amino acids 46 to 48 (3 residues), see Phobius details transmembrane" amino acids 12 to 45 (34 residues), see Phobius details amino acids 349 to 368 (20 residues), see Phobius details PF14870: PSII_BNR" amino acids 80 to 139 (60 residues), 30 bits, see alignment E=6.4e-11 amino acids 176 to 243 (68 residues), 30.8 bits, see alignment E=3.7e-11

Best Hits

KEGG orthology group: None (inferred from 40% identity to azo:azo1838)

Predicted SEED Role

"FIG002465: BNR repeat protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z4A4 at UniProt or InterPro

Protein Sequence (373 amino acids)

>Pf6N2E2_1846 FIG002465: BNR repeat protein (Pseudomonas fluorescens FW300-N2E2)
MGVRFESPEVRFVMLAGILFYSAPLPRSILGRLLFVCLSLAMPFVHAFEPPLQVAAVHSE
RMAAGPMLAITRAGERLVAVGLRGAILFSDDQGRSWSQAQVPVSVDLVAVAFANATQGWA
VGHGGVILHSDDAGATWQKQLDGLQASQLAIDFYTASAARVADAAGYLEKEKRLAVDHET
QPFLDVYFADELHGYVVGTFNRIFATEDGGRSWLPQMHLTNNPQEWHFYAVTGRNGQLYL
SGEQGHVWRRDAQSEQFVSIDTPYNGTLFGVTATEGEVYAYGMRGSFFRSADQGQSWSRT
TLPLGSNLMRVLPLGAQRLLVVAQSGEALLSDDGARIFKPLRLSQPMPYYGAVLLGDSRL
ALVGALGIRVEDL