Protein Info for Pf6N2E2_1829 in Pseudomonas fluorescens FW300-N2E2

Annotation: Mesaconyl-CoA C1-C4 CoA transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 PF02515: CoA_transf_3" amino acids 6 to 376 (371 residues), 200.1 bits, see alignment E=3.2e-63

Best Hits

Swiss-Prot: 57% identical to MCT_CHLAA: 2-methylfumaryl-CoA isomerase (mct) from Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)

KEGG orthology group: K14470, mesaconyl-CoA C1-C4 CoA transferase (inferred from 57% identity to chl:Chy400_0188)

MetaCyc: 57% identical to mesaconyl-C1-CoA-C4-CoA transferase monomer (Chloroflexus aurantiacus)
RXN-13230 [EC: 5.4.1.3]

Predicted SEED Role

"Mesaconyl-CoA C1-C4 CoA transferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUI2 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Pf6N2E2_1829 Mesaconyl-CoA C1-C4 CoA transferase (Pseudomonas fluorescens FW300-N2E2)
MSEAILKGMRVIEVSAFVAAPLGGMTLAQMGADVIRVDGLDGGLDYRRWPVTDDNTSLFW
AGLNKGKRSVAIDINKPQGRELAQALITAPGLDAGMLLTNFPPRGWLDYDTLRAQRADLI
QLTIQGDRHGGSAVDYTINPRIGLPYLTGPQDVDGAVNHVLPAWDLITGQMAAVGLLAAE
RQRSRQGIGQQVKLALEDVALAVMGHLGFLAEAQRGVQRQRHGNDLFGAFGRDFVTRDGQ
RIMVVGLTLKQWRSLCEVTAITEQVEALGRHLQVDLNREGERFHAREALASLVSPWVAER
TLEEITALFEDSGVCWSHYQSISTLLEEDPSCSEQNPLFKLLEQPGIGQILTPGMPLRFN
GHYRTPQPAPQLGADTEAVLMDVLGLSSSEFGALHDQGLVRIAHR