Protein Info for Pf6N2E2_1782 in Pseudomonas fluorescens FW300-N2E2

Annotation: STAS domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF01740: STAS" amino acids 11 to 94 (84 residues), 47.2 bits, see alignment E=1.7e-16 PF13466: STAS_2" amino acids 12 to 91 (80 residues), 45.4 bits, see alignment E=8e-16

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a2246)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z3W6 at UniProt or InterPro

Protein Sequence (105 amino acids)

>Pf6N2E2_1782 STAS domain protein (Pseudomonas fluorescens FW300-N2E2)
MTNTTACLRRILVLEGPLTIYTAAERKDLLLELFPLAQEVEMDLGGVDEMDTAGLQLLVL
IKQESLRHGSNLLLSNHSTAVLDALDMSGLHSFFDQSAPALQQRG