Protein Info for Pf6N2E2_1745 in Pseudomonas fluorescens FW300-N2E2

Annotation: Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 305 to 332 (28 residues), see Phobius details amino acids 359 to 384 (26 residues), see Phobius details

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 47% identity to pau:PA14_07890)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z3L4 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Pf6N2E2_1745 Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1) (Pseudomonas fluorescens FW300-N2E2)
VLLLLPLLIYTAVFFVLPIGMMLYRAVSNPELIQAFPRTVQVLEQQPPSDAQGLPGDAVF
EAIEQDFIHVENMGVMGEAARRMNYENSGYRFLITATARRYQWPAKQQPVSGESSRARLT
AIDPRWSTPELWQAFERASPAYTSYYLLSALDLERTAHGIQRVAPDKRVYLDLTFKTLKI
AFVVSVLCLLLGFPFAVLLVKASRPFQMLLILAVMLPFWTSLLARTTAWIVVLQEKGIVN
TLLLKLGLIEQPLPMIFDALGVYIVMVHILLPFTVLPLYSVMKGIPAHYMRASQSLGAHP
VRGFLHVYLPMTLTGIGSGTLLTFIVAAGYYVTPTLVGSAREQMLGYFIAFYTNTTVNWG
MASALGLVLILCVMAIYLVAARLVGIRQIAGLK