Protein Info for Pf6N2E2_1687 in Pseudomonas fluorescens FW300-N2E2

Annotation: putative iron ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF00005: ABC_tran" amino acids 29 to 160 (132 residues), 84 bits, see alignment E=1.6e-27

Best Hits

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 60% identity to rlg:Rleg_2251)

Predicted SEED Role

"putative iron ABC transporter ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZTZ5 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Pf6N2E2_1687 putative iron ABC transporter ATP-binding protein (Pseudomonas fluorescens FW300-N2E2)
MVTIRLENLGARYGQRTVIHGVTTAAFVGGQVVAVVGPNAAGKSTLFKRMAGLIDGPGQV
VLEGSKKGPPGISYMPQGLNASARLTVYESVLLARKQLTPGWVVHDDELKRVDDILAALG
ITELSFRNLGELSGGQQQLVSIAQTLVREPEILLMDEPTSALDMHRQVQVLGFMRALARK
REVIVFIAIHDLNQALRFADQVLVVADGTAQGSGPSAEVITESMLRKVYKVEARIERCSR
GQHHILIDDIV