Protein Info for Pf6N2E2_1664 in Pseudomonas fluorescens FW300-N2E2

Annotation: Nitrate/nitrite transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 27 to 44 (18 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 130 to 155 (26 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details amino acids 422 to 441 (20 residues), see Phobius details PF07690: MFS_1" amino acids 35 to 404 (370 residues), 137.8 bits, see alignment E=2.2e-44

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a2332)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZU71 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Pf6N2E2_1664 Nitrate/nitrite transporter (Pseudomonas fluorescens FW300-N2E2)
MQTISEQLPAQAPACELDFEDRTYRKVIWRILPVLLLCYMAAYLDRVNIGFAKLDMLNEL
QFSNTVYALGASMFFWGYFLFEVPSNLLLHRFGARFWIARIMLSWAVISMAVAYTVPLAG
FFHIESSSMFYVLRFLLGICEAGFFPGVILYLNYWFPTHRQSRVMSGFLLALPVSLTLGG
ILSGWLMNSMQGVHGLSGWQWMLLIEGIPSIIMAFVVIVCLADNIDKAKWLSVAEKALLK
ANLQTDNQGKATRLSEVFFNPRVWLLVLILLTFNTGFYGLAFWMPSIIKSTGITNSLHIG
LLTAIPYSVAVVAMLLNARHSNRTGERRLHAAIPAFIGGAGLILSAFFADNLVLSVLFLS
VSASGILSLMPIFWTLPGTVLSGVAAAAGIGMINAIGNLSGFTGSMITAVAETLTGNINN
GTYVLALCLLVSGGLILAIPASMLGRTPKHATTAAQLETA