Protein Info for Pf6N2E2_1640 in Pseudomonas fluorescens FW300-N2E2

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 790 transmembrane" amino acids 40 to 63 (24 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 354 to 516 (163 residues), 156.5 bits, see alignment E=2.5e-50 PF00990: GGDEF" amino acids 357 to 514 (158 residues), 176.9 bits, see alignment E=2.8e-56 PF00563: EAL" amino acids 535 to 769 (235 residues), 221.5 bits, see alignment E=1.1e-69

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a2382)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z2W9 at UniProt or InterPro

Protein Sequence (790 amino acids)

>Pf6N2E2_1640 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Pseudomonas fluorescens FW300-N2E2)
MAIQRASVLTSAQDVAPRENPLSDATSDLFRRRFDQVKEAYILFPLLAALLLSVIWAGTL
YLIKVEQTRAQRGIAEASLEIGATYEAQILRAVREIDQTLKLVKYTYESERETNPLPKLK
ARALLPSPYLFDVSVVDARGLVVASTQSSEVGNRIAKDELQAVGRDTALSISRPWKSPAT
GEWKLRFSRRLDTGDGAFAGIAMVEVDAAYFVSSYDTSKLGNQGLLGLLGIDGVFRARRS
GEAISAGNEVDYAAVVPDTENTDAVRLINGTDGVRRYTSARQLYDFPLAVIVGLSEEEQL
ATVTRQAHTYLWRTAGGSLLLVLLAGLLARMSWQLVQSRLRAGEAKIAYAENVEYLAYHD
GLTALPNRSLFSKLLSQSIGEASRYHRQLAVLFLDLDRFKQVNDTLGHDAGDQLLKEVAL
RLKACLRTSDTVARLGGDEFVILLPELSDDKDVATAAQKVLGAIARPFNLQGQEFRVTAS
VGISVFPQDGLDEQTLKKNADIAMYQAKQCGKNNFQFYSAKLNADSLERMTLELSLRHAL
ERHEFQLHYQAKRDIGSGRITGMEALLRWNHPDLGIVAPMQFIPVAEETGLIVPIGKWVL
KTACQQNVAWQQQGLPCLGVAVNLTARQFADENLLTDLAGILAETGMDARLLELEIAESL
LMQDVKKALNVLTGLKHLKVRIAIDDFGIGYSSLSALEQFPLDVIKIDRSCICDTSSVSE
DKALTEAIIAMGRTLSLTVVAQGVETKEQADFLRDNACDEFQGFYFNKPVPADQFKVLLK
AQAAGTDLDT