Protein Info for Pf6N2E2_1635 in Pseudomonas fluorescens FW300-N2E2

Annotation: ABC-type cobalamin/Fe3+-siderophores transport systems ATPase components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF00005: ABC_tran" amino acids 17 to 166 (150 residues), 111.2 bits, see alignment E=6e-36

Best Hits

Swiss-Prot: 47% identical to FEPC_ECOLI: Ferric enterobactin transport ATP-binding protein FepC (fepC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 55% identity to mme:Marme_0963)

MetaCyc: 47% identical to ferric enterobactin ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZW21 at UniProt or InterPro

Protein Sequence (267 amino acids)

>Pf6N2E2_1635 ABC-type cobalamin/Fe3+-siderophores transport systems ATPase components (Pseudomonas fluorescens FW300-N2E2)
MLKATDVRLSYGEQQILNGVSLDIPEGRFTALIGANGCGKTTLLNVLAHMLRPSAGDVQL
SGKRLGQYSRRTLAQHLALLPQRTTSPAGMSVRELVMQGRFPWQTWWRQWSEQDQQAIDR
AIDLAGISPLLDRSLATLSGGQLQRCWIAMTLAQDTPVILLDEPTTFLDIAHQITLLELL
VDLREQGKTIVAVLHDLNQAARYADHLVMMREGRVLAQGAPAKVFTRDNLKAVFDLDAHI
ITDPYSGDPLCVPQTRRSQPLAVREAM