Protein Info for Pf6N2E2_1634 in Pseudomonas fluorescens FW300-N2E2

Annotation: ABC-type Fe3+-siderophore transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 56 to 74 (19 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 228 to 255 (28 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details PF01032: FecCD" amino acids 11 to 318 (308 residues), 304.2 bits, see alignment E=4.8e-95

Best Hits

KEGG orthology group: None (inferred from 55% identity to mme:Marme_0964)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXR2 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Pf6N2E2_1634 ABC-type Fe3+-siderophore transport system, permease component (Pseudomonas fluorescens FW300-N2E2)
LPVWLGLLMAIALTSLLHLAVGAKDIPWQEAWQALVAYAPGNPDQSVIRGSRLPRLLVAM
LVGASLGLAGAIMQAVGDNPLADPGILGINSGAALFVVFGLLVLPGNDMSMIPLFAFAGA
LVASVGVLLLAGRGHNPIRLTLSGAMIAALFSAITSILLLLDQQGLDSLRRWLTGSIGVT
GGSMQAWVWPYVLLGMCLCLVNVRALNAHRLGPQAAAGMGVNLLKMRVLGLASVVLLSGG
AVALAGPIGFVGLVVPHAARLLFGDDYRRLLLAAPLLGALLLILADIAARTVVRPFELNT
GIVTALIGGPIFVVLVLRKVR