Protein Info for Pf6N2E2_158 in Pseudomonas fluorescens FW300-N2E2

Annotation: Endonuclease I precursor (EC 3.1.21.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF04231: Endonuclease_1" amino acids 26 to 220 (195 residues), 125.5 bits, see alignment E=1.5e-40

Best Hits

Swiss-Prot: 57% identical to DRNE_VIBCH: Extracellular deoxyribonuclease (dns) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01150, deoxyribonuclease I [EC: 3.1.21.1] (inferred from 100% identity to pba:PSEBR_a3714)

MetaCyc: 53% identical to DNA-specific endonuclease I (Escherichia coli K-12 substr. MG1655)
Deoxyribonuclease I. [EC: 3.1.21.1]

Predicted SEED Role

"Endonuclease I precursor (EC 3.1.21.1)" (EC 3.1.21.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YL45 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Pf6N2E2_158 Endonuclease I precursor (EC 3.1.21.1) (Pseudomonas fluorescens FW300-N2E2)
MSVRCLAFLLVFIAMGAQAGAPRTFNEAKKVAWKLYAPQSTEFYCGCKYTGNRVNLAACG
YVPRKNASRAARIEWEHIVPAWQIGHQRQCWQQGGRKNCTRYDPVYQRAEADLHNLVPSI
GEVNGDRSNFSFGWLPVQKGQYGSCLTQVDFKAKKVMPRPSIRGMIARTYFYMSKQYGLR
LSKQDRRLYEAWDKTYPVESWERQRNQSVACVMGRGNEFVGPVDMKACG