Protein Info for Pf6N2E2_1547 in Pseudomonas fluorescens FW300-N2E2

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 103 to 104 (2 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 260 to 278 (19 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details PF00892: EamA" amino acids 30 to 154 (125 residues), 45.6 bits, see alignment E=4.4e-16 amino acids 166 to 302 (137 residues), 41.5 bits, see alignment E=8.4e-15

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a2497)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVA7 at UniProt or InterPro

Protein Sequence (318 amino acids)

>Pf6N2E2_1547 Permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas fluorescens FW300-N2E2)
MNPTKSMSCPSLPKPDWHWLIPLPLLEAALLLTWSSGFVGARFSIDYAPALLVVFWRCVV
VTLVLLPFVARALRRTSPVVLLKNAGIGLLAMAGYLAGITQGIALGVPAGLAALVADLLP
MGLALLAASVLKQRLAWQVWAGLLIGLLGVMLVTQGALAWGNAPWWAYGLPLLGMLSLAV
ATLWQKYLPCAQSLGLLPNLWLQCCVSGLAFALVEAAHGSLAPIPSTGFALSVLWTAGLS
TMGGYGLYWLCLRRATATRVASVLYLSPPITMLWAWVMFDEPLSWQMVSGMAVSGIGIWL
VVGTEARQARRPAPEPKR