Protein Info for Pf6N2E2_1537 in Pseudomonas fluorescens FW300-N2E2

Annotation: monooxygenase, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF07992: Pyr_redox_2" amino acids 9 to 194 (186 residues), 41 bits, see alignment E=4.9e-14 PF13738: Pyr_redox_3" amino acids 12 to 196 (185 residues), 77.6 bits, see alignment E=3.3e-25 PF13450: NAD_binding_8" amino acids 13 to 48 (36 residues), 27.7 bits, see alignment 8.1e-10 PF13434: Lys_Orn_oxgnase" amino acids 112 to 190 (79 residues), 32.1 bits, see alignment E=2.1e-11 PF00743: FMO-like" amino acids 128 to 194 (67 residues), 39.4 bits, see alignment E=8.6e-14

Best Hits

KEGG orthology group: None (inferred from 92% identity to pba:PSEBR_a2507)

MetaCyc: 61% identical to [arsenate oxidoreductase]-[AioE protein] oxidoreductase (Agrobacterium tumefaciens GW4)
1.20.98.-

Predicted SEED Role

"monooxygenase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWE9 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Pf6N2E2_1537 monooxygenase, putative (Pseudomonas fluorescens FW300-N2E2)
MPCSQPETFDVVIIGGGQAALAVAYFLRRTPLSFVILDAQEGPGGAWRHGWNSLRLFSPA
TWSSIPGWMMPPSQDGYPSRDHVVDYLTQYEQRYGFPVVRPVQVTRVEPTETGLRVYATD
KHWDARVVVSATGTWSNPYIPRYLDAALFAGQQLHSANYVEAAPFAGKKVLVVGGGNSGA
QILAEVSKIAETTWVTPIEPLFLPDEVDGRVLFERATERWKAQQEGRVIDQPVGGLGDIV
MVPPVIEARERNVLQAVRPFERFTRNGVIWADGRESAVDVLIWCTGFRPALQHLDALGVL
NNDGRVEVEGTRSIQESRLWLVGYGEWTGSASATLIGVTRTARSTVGEIVDFLARQSMAD
APA