Protein Info for Pf6N2E2_1458 in Pseudomonas fluorescens FW300-N2E2

Annotation: probable transporter, LysE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 37 to 86 (50 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 140 to 165 (26 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details PF01810: LysE" amino acids 14 to 199 (186 residues), 102.7 bits, see alignment E=9.4e-34

Best Hits

Swiss-Prot: 35% identical to RHTB_SALTY: Homoserine/homoserine lactone efflux protein (rhtB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a2593)

MetaCyc: 34% identical to L-homoserine/L-homoserine lactone/L-threonine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-242; TRANS-RXN-242A; TRANS-RXN0-0244

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z1H8 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Pf6N2E2_1458 probable transporter, LysE family (Pseudomonas fluorescens FW300-N2E2)
MAGYGLFLILATLTVLSPGPGVMLTISNALRHGWRGALPGIFGIASGAFIVAGICASSLG
LILAASATAFTLLKYIGALYLLYLGIKMWRTQRFVPELTVTSTRPWRRFGEALSIQLLNP
KAGFFFLAVFPQFIKPLDHYYSQFFLLVLSYSVLVVLVHSGYALMANGARGWLSSSQGAR
IVGKLSGITFLGFGVLMASASK