Protein Info for Pf6N2E2_144 in Pseudomonas fluorescens FW300-N2E2

Annotation: Uncharacterized protein YtfM precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF17243: POTRA_TamA_1" amino acids 21 to 93 (73 residues), 70.7 bits, see alignment E=1.4e-23 PF07244: POTRA" amino acids 184 to 245 (62 residues), 35.2 bits, see alignment E=2.6e-12 PF01103: Omp85" amino acids 276 to 566 (291 residues), 132.2 bits, see alignment E=4.6e-42

Best Hits

KEGG orthology group: K07278, outer membrane protein (inferred from 100% identity to pba:PSEBR_a3727)

Predicted SEED Role

"Uncharacterized protein YtfM precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YKL3 at UniProt or InterPro

Protein Sequence (569 amino acids)

>Pf6N2E2_144 Uncharacterized protein YtfM precursor (Pseudomonas fluorescens FW300-N2E2)
MTSGALLLSLSCVALANSELEVRVKPSNDELKANVEGYIGGVGDRDEEALLRFSRGAEEQ
ARKAAQALGYYQPQIDSEVKGGKDPRLVLTIDPGEPVHLRNVTVRIDGPAASLKAFRVPS
NAALKPGAVLNHGRYEDAKRIIQNQASRYGFFSGRFTRQKLLVDPQAGIADIELIYDSGP
RYALGPVSFEGDTPFDEDLLQRMVPFKAGTAYDSELIAELNQALQSSGYFEGVRVDAAPT
AATDNVIPVAVKLDTRKPRTMGLGLGFSTDVGPRVKANWTRHWVNPQGHSYGWEAEVSAP
RQNVGLWYDVPLDPPLTDKIRYAGGYQYEELAGTDSLSKLLTVGPEWHSKLPSGWQRVVS
LKWQREEYRLGDDAGLSTLLMPGLSYSYLRSDNRIDPHNGYRLQFDTKVAKEGLGSDNNL
LYGTAMVKGLTTVFDKHRLLARAQIGGSATNGYKSIPPSLRFFAGGDQSVRGYDYQSLSP
ENSEGDRIGGRYMVAGSLEYQYSIAEKWRVATFIDQGNSFNSLELPSLKTGVGVGVRWVS
PVGPIRLDLAHAMDDDGGIRLHFSMGPEL