Protein Info for Pf6N2E2_1364 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 323 to 350 (28 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details amino acids 399 to 417 (19 residues), see Phobius details amino acids 431 to 450 (20 residues), see Phobius details PF12801: Fer4_5" amino acids 63 to 107 (45 residues), 38.1 bits, see alignment 5.9e-14 amino acids 147 to 181 (35 residues), 22.6 bits, see alignment 4.3e-09

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a2686)

Predicted SEED Role

"Ferredoxin" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZTM2 at UniProt or InterPro

Protein Sequence (455 amino acids)

>Pf6N2E2_1364 Ferredoxin (Pseudomonas fluorescens FW300-N2E2)
MPDLTPWLQRLGDGMRRHGATIRAVQWVVVLFYAVLLVVPALLPLPSGQARLFDNLTLLA
QFLFWGLWWPFVLLSIVLFGRLWCGVLCPEGALSEWASQYGKGLGVPRGLRWAGWPTLAF
CLTTLYGQLISVYDYAQAALLILGGSTVAAVIVGLLFARGKRVWCRYLCPVSGVFSLLAR
LAPVHFQVDEQRWLENPAPRRPPPNCAPLLDIRRMRGAADCHACGRCSGQRDAVRLIARS
SSEEILHSTANTLSPWDVRLLLFGVIGLAMGAFQWTVSPWFIDLKQSLAQWLVSHDWLWA
LQDNAPWWLLTHYPQLNDSFSWLDGFCIVAYLGMSALLIGTSLMLLMRLAARLSGDSTQY
PPLAITLTPLGGAGLFLGLSATTVKLLRYEGLLLEWVQPARAVLLIAAIAWSLWLGCKRL
QQAQTPPIRRWPAMACLVLASSLVGYGWWLQFWGW