Protein Info for Pf6N2E2_1323 in Pseudomonas fluorescens FW300-N2E2

Annotation: 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF23441: SDR" amino acids 9 to 250 (242 residues), 41.9 bits, see alignment E=1.6e-14 PF00106: adh_short" amino acids 10 to 203 (194 residues), 188.5 bits, see alignment E=1.9e-59 PF08659: KR" amino acids 11 to 172 (162 residues), 64.3 bits, see alignment E=2.8e-21 PF13561: adh_short_C2" amino acids 18 to 251 (234 residues), 219.8 bits, see alignment E=8.1e-69

Best Hits

Swiss-Prot: 35% identical to UCPA_ECO57: Oxidoreductase UcpA (ucpA) from Escherichia coli O157:H7

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 94% identity to pba:PSEBR_a2728)

MetaCyc: 35% identical to oxidoreductase UcpA (Escherichia coli K-12 substr. MG1655)
RXN-11032 [EC: 1.1.1.304]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.304

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZTI9 at UniProt or InterPro

Protein Sequence (255 amino acids)

>Pf6N2E2_1323 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100) (Pseudomonas fluorescens FW300-N2E2)
MSEDLDFSGQTVLVTGGAQGIGRAIVEAFALRGARVVIADLGLARAEAVADELTAEGCQV
QAVGVDLADATAVFGMMAELEQRLGRLDILIHNAGYFPLTPFAEITPSMLDRTLAVNLSA
LFWLTQAALPMFRRQGQGCVLVTSSVTGPRVAYPGLSHYAASKAGVNGFIRNAALELAAE
NVRVNGVEPGMIATPAMANLGDDEVNQDIARRVPLGRLGQPSDIAGAMLYLASSLASYVT
GQTLVVDGGSTLPEV