Protein Info for Pf6N2E2_1305 in Pseudomonas fluorescens FW300-N2E2

Annotation: Homoprotocatechuate degradative operon repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 TIGR02337: homoprotocatechuate degradation operon regulator, HpaR" amino acids 1 to 129 (129 residues), 192.8 bits, see alignment E=9.3e-62 PF22381: Staph_reg_Sar_Rot" amino acids 15 to 94 (80 residues), 36.5 bits, see alignment E=8.7e-13 PF12802: MarR_2" amino acids 23 to 82 (60 residues), 35.3 bits, see alignment E=2.1e-12 PF01047: MarR" amino acids 25 to 83 (59 residues), 62.6 bits, see alignment E=5.2e-21 PF13463: HTH_27" amino acids 25 to 91 (67 residues), 25.5 bits, see alignment E=2.6e-09

Best Hits

Swiss-Prot: 54% identical to HPCR_ECOLX: Homoprotocatechuate degradative operon repressor (hpcR) from Escherichia coli

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a2746)

Predicted SEED Role

"Homoprotocatechuate degradative operon repressor" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z0D2 at UniProt or InterPro

Protein Sequence (133 amino acids)

>Pf6N2E2_1305 Homoprotocatechuate degradative operon repressor (Pseudomonas fluorescens FW300-N2E2)
LTLTLLQAREAAMAFFRPALNQHDLTEQQWRVIRILHQQGELESHQLAHQACILKPSMTG
VLSRLERDGLVRRQKSSQDQRRVFVGLTERGQQCFVSMSEGMEGNYRRIEEQFGEEKMEQ
LLGLLNELKNIKP