Protein Info for Pf6N2E2_1285 in Pseudomonas fluorescens FW300-N2E2

Annotation: MotA/TolQ/ExbB proton channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 368 to 387 (20 residues), see Phobius details amino acids 491 to 515 (25 residues), see Phobius details amino acids 523 to 547 (25 residues), see Phobius details PF10102: DUF2341" amino acids 71 to 149 (79 residues), 69.6 bits, see alignment E=3.9e-23 PF13385: Laminin_G_3" amino acids 199 to 322 (124 residues), 68.4 bits, see alignment E=1.2e-22 PF01618: MotA_ExbB" amino acids 456 to 562 (107 residues), 92.4 bits, see alignment E=2.9e-30

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 97% identity to pba:PSEBR_a2788)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVA2 at UniProt or InterPro

Protein Sequence (599 amino acids)

>Pf6N2E2_1285 MotA/TolQ/ExbB proton channel family protein (Pseudomonas fluorescens FW300-N2E2)
MQRLLLSLFICLGLVLPATANAWWQDDWHYRKQISVDTTPQGAAIAQALGRTALLVRLHT
GNFTFDGVKEDGSDLRFVSADDKTVLNHQIESFDPLMGMALIWVDVPNVEGGQRQDMWMY
YGNQKAPATGSGQLTFDPDYTALYHFEGATGVPPRDTTAYGNNAQGAAGVSIDGVIGRAL
QFNGQPLLLPASPSLQHSAGAAFTFSTWLRQDQASGEQIILARREATTSLLIGVNQGVPF
VAINDQRAVSTQPLNPGQWQHLALTASGDRVVLYVNGRETASLAVAMPAFNSPMALGADV
SAGAFAPFGGAMDEARLSKVARPAPLLLADANAQGAESKLVAYGVDEEQSGFGFGSLGFL
LNAVPMDAWVIIGVLVLMMFQSWIIMIRKNRMVSRLSAANEAFREQFARIGTRLEMFADD
QDLAQRLQHSSLWRLYLVAVKEIRTRREQGADTSSVSAATIEAIRCSMDGVRTRENQQLS
SKLSTLSNAIAGGPYIGLLGTVLGIMVVFLGTAMAGDVNINAIAPGMAAALLATAMGLFV
AIPALFGYNRLITRNKEVSADMRVFVDEFITRLAEMHGEGQSGEAAHRRNHHAPSSVPA