Protein Info for Pf6N2E2_121 in Pseudomonas fluorescens FW300-N2E2

Annotation: probable polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02563: Poly_export" amino acids 65 to 134 (70 residues), 46 bits, see alignment E=7.1e-16 amino acids 158 to 213 (56 residues), 32.8 bits, see alignment E=9.9e-12 PF22461: SLBB_2" amino acids 222 to 301 (80 residues), 38.4 bits, see alignment E=1.6e-13 PF10531: SLBB" amino acids 223 to 270 (48 residues), 35 bits, see alignment 1.5e-12

Best Hits

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a3751)

Predicted SEED Role

"probable polysaccharide biosynthesis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YJQ7 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Pf6N2E2_121 probable polysaccharide biosynthesis protein (Pseudomonas fluorescens FW300-N2E2)
MNARMLVLLLLPLAGCSSTSDTRSMPVQILTAAPANAQATDMPKVEQTLRPQDVLDVIFH
IGTTSSQAYRVQPGDQVALNFTAASQLNGTQQVMPDGTIELPGANTSVKVAGLTTDEARL
AVQRAYDQKMLFQPNRNQLTVLVTSPLSGEANLRNTLTHPATGMSREIIVGRDGYASFPE
IGSVPLQGMTVTQLETFLNERYAQLPGHMTVDVLLKSTAGNEIYVLGEVAQPGAYAIRRP
ISVLEALTLARGTNVKARLDSVMIMRRNGNQVEARHYDVEKALSGDASQIAYLQPEDMLY
VPKTGLAKAGETARQLADVVLFQGVGFGFGYRVDNKGSDN