Protein Info for Pf6N2E2_1161 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG00961921: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF06325: PrmA" amino acids 45 to 145 (101 residues), 24 bits, see alignment E=1e-08 PF13489: Methyltransf_23" amino acids 45 to 199 (155 residues), 57.3 bits, see alignment E=6.7e-19 PF07021: MetW" amino acids 47 to 91 (45 residues), 27.4 bits, see alignment 1e-09 PF13847: Methyltransf_31" amino acids 49 to 149 (101 residues), 28 bits, see alignment E=6.8e-10 PF13649: Methyltransf_25" amino acids 51 to 141 (91 residues), 44.7 bits, see alignment E=7.4e-15 PF08241: Methyltransf_11" amino acids 52 to 145 (94 residues), 40.2 bits, see alignment E=1.7e-13 PF08242: Methyltransf_12" amino acids 52 to 143 (92 residues), 43.4 bits, see alignment E=1.9e-14

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a2920)

Predicted SEED Role

"FIG00961921: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YZA2 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Pf6N2E2_1161 FIG00961921: hypothetical protein (Pseudomonas fluorescens FW300-N2E2)
MSSSETTLLQSWHHNAQSWIEAIRTGAIESRLTVTDQAMLLVVQSRQPERVLDLGCGEGW
LLRALADRGIEAVGVDGDATLVEAARAAGSSPVHLASYEALVQEKVDVGSGYDLICANFA
LLHQDIIPLLAAMNALLSPGGALVVQTLHPWTVAAGDYQDGWREETFDGFKGQWQRMPWY
FRTLSSWLNALDMAGFRLVLLQEPQHPQSPVPQSLLLVAEQSPSWC