Protein Info for Pf6N2E2_1141 in Pseudomonas fluorescens FW300-N2E2

Annotation: Lipid-A-disaccharide synthase (EC 2.4.1.182)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 97 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details PF07578: LAB_N" amino acids 10 to 80 (71 residues), 110 bits, see alignment E=2.4e-36

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a2941)

Predicted SEED Role

"Lipid-A-disaccharide synthase (EC 2.4.1.182)" in subsystem KDO2-Lipid A biosynthesis (EC 2.4.1.182)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.182

Use Curated BLAST to search for 2.4.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZSS8 at UniProt or InterPro

Protein Sequence (97 amino acids)

>Pf6N2E2_1141 Lipid-A-disaccharide synthase (EC 2.4.1.182) (Pseudomonas fluorescens FW300-N2E2)
MGRESLWLAVGFGGQLAFTGRFALQWLYSEYKKRSMIPVGFWYLSIVGSALLLAYAIYRE
DPVFIVGQSFGFIVYLRNLQLIAKHHEQENPELAKKG