Protein Info for Pf6N2E2_1081 in Pseudomonas fluorescens FW300-N2E2

Annotation: probable membrane protein YPO3302

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details PF09335: VTT_dom" amino acids 26 to 138 (113 residues), 46.8 bits, see alignment E=2.1e-16

Best Hits

Swiss-Prot: 43% identical to YQAA_ECOLI: Inner membrane protein YqaA (yqaA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a3003)

Predicted SEED Role

"probable membrane protein YPO3302"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YYQ1 at UniProt or InterPro

Protein Sequence (144 amino acids)

>Pf6N2E2_1081 probable membrane protein YPO3302 (Pseudomonas fluorescens FW300-N2E2)
MGEAYIGLFLAAFGAATLLPLQSEAVLVGLLLSERHLVWLLLAVATLGNVLGSLVNWWLG
TRLEHFKDRRWFPVSPAHLDKARVHYQRFGHWSLLLSWLPIIGDPLTLVAGVMGEPWRRF
LLLVSLAKGLRYGVLALATLGWMD