Protein Info for Pf6N2E2_1080 in Pseudomonas fluorescens FW300-N2E2

Annotation: hydrolase, alpha/beta fold family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF06342: DUF1057" amino acids 56 to 184 (129 residues), 34.4 bits, see alignment E=3.3e-12 PF00561: Abhydrolase_1" amino acids 75 to 327 (253 residues), 85.7 bits, see alignment E=1e-27 PF12146: Hydrolase_4" amino acids 75 to 277 (203 residues), 58.7 bits, see alignment E=1.4e-19 PF12697: Abhydrolase_6" amino acids 76 to 331 (256 residues), 69.5 bits, see alignment E=1.6e-22 PF03096: Ndr" amino acids 120 to 176 (57 residues), 23.9 bits, see alignment E=4.1e-09

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a3004)

Predicted SEED Role

"hydrolase, alpha/beta fold family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWN9 at UniProt or InterPro

Protein Sequence (343 amino acids)

>Pf6N2E2_1080 hydrolase, alpha/beta fold family (Pseudomonas fluorescens FW300-N2E2)
MPRTPARWLPSLFLTAALPLFALAATPPEGPAYGALLEGFEYPYTLKRFAFQSQGQSLQM
GYMDVPAQGKVNGRTVVLMHGKNFCAATWGDSIKVLSEAGYRVIAADQIGFCTSSKPEHY
QYSFQQLASNTQALLKALGVQKAVILGHSTGGMLATRYALQFPDEVERLAMVNPIGLEDW
KALGVPYRTVDQWYARELKVNAEGIRNYERTTYYAGRWKPEFERWVDMLAGLNKGPGHTQ
VAWNSALIYDMIFTQPVYYEFKDLTVPTLLLIGTSDTTAIGSDIAPPAVKAKLGHYEVLG
KQAARLIPSSTLVEFPNLGHAPQMEEPDRFHKALLSWLDKPIP