Protein Info for Pf6N2E2_1047 in Pseudomonas fluorescens FW300-N2E2

Annotation: Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF08240: ADH_N" amino acids 27 to 113 (87 residues), 45 bits, see alignment E=1.7e-15 PF00107: ADH_zinc_N" amino acids 155 to 238 (84 residues), 60.6 bits, see alignment E=2.4e-20 PF13602: ADH_zinc_N_2" amino acids 186 to 328 (143 residues), 83.7 bits, see alignment E=3.5e-27

Best Hits

KEGG orthology group: None (inferred from 40% identity to rer:RER_53320)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVB2 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Pf6N2E2_1047 Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase (Pseudomonas fluorescens FW300-N2E2)
MRASYLTAYGDNEVVSSGELPDPVLSEGTSLIEIKAAGVNPVELGMRAGGFQRVLPYSFP
QVPGFDISGVVREVSGPSQFKVGDEVYARMSNRAPGAYAELAVVTNDLLAKKPTKISHIE
AASLPTVALTAWQAFFERANLKNGDRVLIQAGAGGVGTFAIQLAKHFGAHVTATAGTANQ
AFLKELGADIAVDYTKQRFEDFGPFDVVYDGVCGELVERSINTLAPGGRYVGLVMMADTR
AFMSLGLPEAIAKGAAAGIAKYEELAASRGAEFHGPLTRPDAIQLAEIAKLVNAGIIKPH
VSRVFGLNQLKQAYEAVGSGHTRGKLVLDTSKLI